Lineage for d1v8ba2 (1v8b A:4-234,A:398-479)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579189Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 579254Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 579255Protein S-adenosylhomocystein hydrolase [52301] (3 species)
    contains additional secondary structures disguising the superfamily fold
  7. 579260Species Plasmodium falciparum, isolate 3D7 [TaxId:5833] [117480] (1 PDB entry)
  8. 579261Domain d1v8ba2: 1v8b A:4-234,A:398-479 [113565]
    Other proteins in same PDB: d1v8ba1, d1v8bb1, d1v8bc1, d1v8bd1

Details for d1v8ba2

PDB Entry: 1v8b (more details), 2.4 Å

PDB Description: Crystal structure of a hydrolase
PDB Compounds: (A:)

SCOP Domain Sequences for d1v8ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7}
nkskvkdislapfgkmqmeisenempglmrireeygkdqplknakitgclhmtvecalli
etlqklgaqirwcscniystadyaaaavstlenvtvfawknetleeywwcvesaltwgdg
ddngpdmivddggdatllvhkgveyeklyeeknilpdpekakneeercfltllknsilkn
pkkwtniakkiigvseetttgvlrlkkmdkqnellftainvndavtkqkydXhpafvmsf
sfcnqtfaqldlwqnkdtnkyenkvyllpkhldekvalyhlkklnasltelddnqcqflg
vnksgpfksneyry

SCOP Domain Coordinates for d1v8ba2:

Click to download the PDB-style file with coordinates for d1v8ba2.
(The format of our PDB-style files is described here.)

Timeline for d1v8ba2: