SCOP 1.71: Domain d1v7lb_: 1v7l B:

Lineage for d1v7lb_ (1v7l B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.2: LeuD-like [52016] (1 family)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.2.1: LeuD-like [52017] (3 proteins)
   Pfam 00694; permutation of the domain order in the proteins containing this family domain

6. Protein Isopropylmalate isomerase LeuD [117454] (1 species)
   3-isopropylmalate dehydratase small subunit

7. Species Pyrococcus horikoshii [TaxId:70601] [117455] (1 PDB entry)

8. Domain d1v7lb_: 1v7l B: [113563]

Details for d1v7lb_

PDB Entry: 1v7l, 1.98 Å

PDB Description: Structure of 3-isopropylmalate isomerase small subunit from Pyrococcus horikoshii

SCOP Domain Sequences for d1v7lb_:

Sequence; same for both SEQRES and ATOM records:

>d1v7lb_ c.8.2.1 (B:) Isopropylmalate isomerase LeuD {Pyrococcus horikoshii}
mittgkvwkfgddistdeitpgrynltkdpkelakiafievrpdfarnvrpgdvvvagkn
fgigssresaalalkalgiagviaesfgrifyrnainigiplllgkteglkdgdlvtvnw
etgevrkgdeilmfepledflleivreggileyirrrgdlcir

Timeline for d1v7lb_:

• d1v7lb_ is new in SCOP 1.71
  
• d1v7lb_ appears in SCOP 1.73
  
• d1v7lb_ appears in the current release, SCOPe 2.08