Lineage for d1v7aa_ (1v7a A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683612Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 683613Family c.1.9.1: Adenosine/AMP deaminase [51557] (2 proteins)
  6. 683614Protein Adenosine deaminase (ADA) [51558] (3 species)
    Common fold covers the whole protein structure
  7. 683615Species Cow (Bos taurus) [TaxId:9913] [82257] (16 PDB entries)
  8. 683627Domain d1v7aa_: 1v7a A: [113560]
    complexed with frc, zn

Details for d1v7aa_

PDB Entry: 1v7a (more details), 2.5 Å

PDB Description: Crystal structures of adenosine deaminase complexed with potent inhibitors
PDB Compounds: (A:) adenosine deaminase

SCOP Domain Sequences for d1v7aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7aa_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Cow (Bos taurus) [TaxId: 9913]}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr

SCOP Domain Coordinates for d1v7aa_:

Click to download the PDB-style file with coordinates for d1v7aa_.
(The format of our PDB-style files is described here.)

Timeline for d1v7aa_: