Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.9: TM1287-like [89409] (5 proteins) |
Protein Hypothetical protein TTHA0104 [117310] (1 species) |
Species Thermus thermophilus [TaxId:274] [117311] (2 PDB entries) Uniprot Q5SM39 |
Domain d1v70a_: 1v70 A: [113555] Structural genomics target complexed with na |
PDB Entry: 1v70 (more details), 1.3 Å
SCOPe Domain Sequences for d1v70a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp
Timeline for d1v70a_: