Lineage for d1v70a_ (1v70 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814807Family b.82.1.9: TM1287-like [89409] (5 proteins)
  6. 2814821Protein Hypothetical protein TTHA0104 [117310] (1 species)
  7. 2814822Species Thermus thermophilus [TaxId:274] [117311] (2 PDB entries)
    Uniprot Q5SM39
  8. 2814823Domain d1v70a_: 1v70 A: [113555]
    Structural genomics target
    complexed with na

Details for d1v70a_

PDB Entry: 1v70 (more details), 1.3 Å

PDB Description: Crystal Structure of probable antibiotics synthesis protein from Thermus thermophilus HB8
PDB Compounds: (A:) probable antibiotics synthesis protein

SCOPe Domain Sequences for d1v70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]}
meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev
vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp

SCOPe Domain Coordinates for d1v70a_:

Click to download the PDB-style file with coordinates for d1v70a_.
(The format of our PDB-style files is described here.)

Timeline for d1v70a_: