Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.5: YggJ C-terminal domain-like [89632] (4 proteins) contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain |
Protein Hypothetical protein TTHA0657 (TT1575) [117494] (1 species) |
Species Thermus thermophilus [TaxId:274] [117495] (3 PDB entries) Uniprot Q5SKI6 |
Domain d1v6zb2: 1v6z B:67-228 [113554] Other proteins in same PDB: d1v6za1, d1v6zb1 Structural genomics target |
PDB Entry: 1v6z (more details), 2 Å
SCOPe Domain Sequences for d1v6zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v6zb2 c.116.1.5 (B:67-228) Hypothetical protein TTHA0657 (TT1575) {Thermus thermophilus [TaxId: 274]} revgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrlraval eaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalavgpeggf aeeevalleargftpvslgrrilraetaalallalctagegr
Timeline for d1v6zb2: