Lineage for d1v6zb2 (1v6z B:67-228)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712757Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 712758Superfamily c.116.1: alpha/beta knot [75217] (5 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 712824Family c.116.1.5: YggJ C-terminal domain-like [89632] (3 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain
  6. 712831Protein Hypothetical protein TTHA0657 (TT1575) [117494] (1 species)
  7. 712832Species Thermus thermophilus [TaxId:274] [117495] (2 PDB entries)
  8. 712834Domain d1v6zb2: 1v6z B:67-228 [113554]
    Other proteins in same PDB: d1v6za1, d1v6zb1
    Structural genomics target

Details for d1v6zb2

PDB Entry: 1v6z (more details), 2 Å

PDB Description: crystal structure of tt1573 from thermus thermophilus
PDB Compounds: (B:) hypothetical protein TTHA0657

SCOP Domain Sequences for d1v6zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6zb2 c.116.1.5 (B:67-228) Hypothetical protein TTHA0657 (TT1575) {Thermus thermophilus [TaxId: 274]}
revgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrlraval
eaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalavgpeggf
aeeevalleargftpvslgrrilraetaalallalctagegr

SCOP Domain Coordinates for d1v6zb2:

Click to download the PDB-style file with coordinates for d1v6zb2.
(The format of our PDB-style files is described here.)

Timeline for d1v6zb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v6zb1