SCOP 1.71: Domain d1v6zb2: 1v6z B:67-228

Lineage for d1v6zb2 (1v6z B:67-228)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (5 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.5: YggJ C-terminal domain-like [89632] (3 proteins)
   contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain

6. Protein Hypothetical protein TTHA0657 (TT1575) [117494] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117495] (1 PDB entry)

8. Domain d1v6zb2: 1v6z B:67-228 [113554]
   Other proteins in same PDB: d1v6za1, d1v6zb1
   Structural genomics target

Details for d1v6zb2

PDB Entry: 1v6z, 2 Å

PDB Description: crystal structure of tt1573 from thermus thermophilus

SCOP Domain Sequences for d1v6zb2:

Sequence; same for both SEQRES and ATOM records:

>d1v6zb2 c.116.1.5 (B:67-228) Hypothetical protein TTHA0657 (TT1575) {Thermus thermophilus}
revgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrlraval
eaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalavgpeggf
aeeevalleargftpvslgrrilraetaalallalctagegr

Timeline for d1v6zb2:

• d1v6zb2 is new in SCOP 1.71
  
• d1v6zb2 appears in SCOP 1.73
  
• d1v6zb2 appears in the current release, SCOPe 2.08