Lineage for d1v6ta_ (1v6t A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577009Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 577051Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (5 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 577084Family c.6.2.5: LamB/YcsF-like [117449] (2 proteins)
    Pfam 03746
  6. 577085Protein Hypothetical protein PH0986 [117452] (1 species)
  7. 577086Species Pyrococcus horikoshii [TaxId:70601] [117453] (1 PDB entry)
  8. 577087Domain d1v6ta_: 1v6t A: [113550]
    Structural genomics target

Details for d1v6ta_

PDB Entry: 1v6t (more details), 1.7 Å

PDB Description: Crystal Structure of Lactam Utilization Protein from Pyrococcus horikoshii Ot3

SCOP Domain Sequences for d1v6ta_:

Sequence, based on SEQRES records: (download)

>d1v6ta_ c.6.2.5 (A:) Hypothetical protein PH0986 {Pyrococcus horikoshii}
mrvdlnsdlgesfgryklgldeevmkyitsanvacgwhagdplvmrktvrlakendvqvg
ahpgypdlmgfgrrymkltpeearnyilyqvgalyafakaeglelqhvkphgalynamvk
eedlaraviegildfdkdlilvtlsnsrvadiaeemglkvahevfadraynpdgtlvprg
rpgaviedkeeiaervismvkdggiraingewvdlkvdticvhgdnpkaveitsyirkvl
eeegvkivpmkefi

Sequence, based on observed residues (ATOM records): (download)

>d1v6ta_ c.6.2.5 (A:) Hypothetical protein PH0986 {Pyrococcus horikoshii}
mrvdlnsdlgesfgryklgldeevmkyitsanvacgwhagdplvmrktvrlakendvqvg
ahpgypdlmgfgrrymkltpeearnyilyqvgalyafakaeglelqhvkphgalynamvk
eedlaraviegildfdkdlilvtlsnsrvadiaeemglkvahevfadraynpdgtlvpav
iedkeeiaervismvkdggiraingewvdlkvdticvhgdnpkaveitsyirkvleeegv
kivpmkefi

SCOP Domain Coordinates for d1v6ta_:

Click to download the PDB-style file with coordinates for d1v6ta_.
(The format of our PDB-style files is described here.)

Timeline for d1v6ta_: