Lineage for d1v6pb_ (1v6p B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259040Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2259162Protein Cobrotoxin II (ct2) [57341] (2 species)
  7. 2259165Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57342] (3 PDB entries)
    Uniprot P60770 22-83
  8. 2259167Domain d1v6pb_: 1v6p B: [113549]
    complexed with cl, cu, eoh, na

Details for d1v6pb_

PDB Entry: 1v6p (more details), 0.87 Å

PDB Description: Crystal structure of Cobrotoxin
PDB Compounds: (B:) cobrotoxin

SCOPe Domain Sequences for d1v6pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6pb_ g.7.1.1 (B:) Cobrotoxin II (ct2) {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lechnqqssqtptttgcsggetncykkrwrdhrgyrtergcgcpsvkngieinccttdrc
nn

SCOPe Domain Coordinates for d1v6pb_:

Click to download the PDB-style file with coordinates for d1v6pb_.
(The format of our PDB-style files is described here.)

Timeline for d1v6pb_: