Lineage for d1v6pa_ (1v6p A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2636875Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2636997Protein Cobrotoxin II (ct2) [57341] (2 species)
  7. 2637000Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57342] (3 PDB entries)
    Uniprot P60770 22-83
  8. 2637001Domain d1v6pa_: 1v6p A: [113548]
    complexed with cl, cu, eoh, na

Details for d1v6pa_

PDB Entry: 1v6p (more details), 0.87 Å

PDB Description: Crystal structure of Cobrotoxin
PDB Compounds: (A:) cobrotoxin

SCOPe Domain Sequences for d1v6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6pa_ g.7.1.1 (A:) Cobrotoxin II (ct2) {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lechnqqssqtptttgcsggetncykkrwrdhrgyrtergcgcpsvkngieinccttdrc
nn

SCOPe Domain Coordinates for d1v6pa_:

Click to download the PDB-style file with coordinates for d1v6pa_.
(The format of our PDB-style files is described here.)

Timeline for d1v6pa_: