Lineage for d1v6ca_ (1v6c A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873308Protein Alkaline serine protease Apa1 [117571] (1 species)
  7. 2873309Species Pseudoalteromonas sp. AS-11 [TaxId:247492] [117572] (1 PDB entry)
    Uniprot Q65Z69 145-579
  8. 2873310Domain d1v6ca_: 1v6c A: [113544]
    complexed with ca, pms, so4
    has additional subdomain(s) that are not in the common domain

Details for d1v6ca_

PDB Entry: 1v6c (more details), 1.8 Å

PDB Description: Crystal Structure of Psychrophilic Subtilisin-like Protease Apa1 from Antarctic Psychrotroph Pseudoalteromonas sp. AS-11
PDB Compounds: (A:) Alkaline serine protease

SCOPe Domain Sequences for d1v6ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6ca_ c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseudoalteromonas sp. AS-11 [TaxId: 247492]}
aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
avaakayldesctgp

SCOPe Domain Coordinates for d1v6ca_:

Click to download the PDB-style file with coordinates for d1v6ca_.
(The format of our PDB-style files is described here.)

Timeline for d1v6ca_: