SCOPe 2.05: Domain d1v66a_: 1v66 A:

Lineage for d1v66a_ (1v66 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
   helix-extended loop-helix; parallel helices

4. Superfamily a.140.2: SAP domain [68906] (1 family)

5. Family a.140.2.1: SAP domain [68907] (8 proteins)
   Pfam PF02037

6. Protein p53 binding domain of protein inhibitor of activated STAT protein 1, PIAS-1 [116764] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116765] (1 PDB entry)
   Uniprot O75925 1-65

8. Domain d1v66a_: 1v66 A: [113543]

Details for d1v66a_

PDB Entry: 1v66

PDB Description: solution structure of human p53 binding domain of pias-1

PDB Compounds: (A:) Protein inhibitor of activated STAT protein 1

SCOPe Domain Sequences for d1v66a_:

Sequence; same for both SEQRES and ATOM records:

>d1v66a_ a.140.2.1 (A:) p53 binding domain of protein inhibitor of activated STAT protein 1, PIAS-1 {Human (Homo sapiens) [TaxId: 9606]}
madsaelkqmvmslrvselqvllgyagrnkhgrkhelltkalhllkagcspavqmkikel
yrrrf

Timeline for d1v66a_:

• d1v66a_ first appeared in SCOP 1.71
  
• d1v66a_ appears in SCOPe 2.04
  
• d1v66a_ appears in SCOPe 2.06
  
• d1v66a_ appears in the current release, SCOPe 2.08