Lineage for d1v66a_ (1v66 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545076Fold a.140: LEM/SAP HeH motif [63450] (5 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 545088Superfamily a.140.2: SAP domain [68906] (1 family) (S)
  5. 545089Family a.140.2.1: SAP domain [68907] (5 proteins)
    Pfam 02037
  6. 545098Protein p53 binding domain of protein inhibitor of activated STAT protein 1, PIAS-1 [116764] (1 species)
  7. 545099Species Human (Homo sapiens) [TaxId:9606] [116765] (1 PDB entry)
  8. 545100Domain d1v66a_: 1v66 A: [113543]

Details for d1v66a_

PDB Entry: 1v66 (more details)

PDB Description: solution structure of human p53 binding domain of pias-1

SCOP Domain Sequences for d1v66a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v66a_ a.140.2.1 (A:) p53 binding domain of protein inhibitor of activated STAT protein 1, PIAS-1 {Human (Homo sapiens)}
madsaelkqmvmslrvselqvllgyagrnkhgrkhelltkalhllkagcspavqmkikel
yrrrf

SCOP Domain Coordinates for d1v66a_:

Click to download the PDB-style file with coordinates for d1v66a_.
(The format of our PDB-style files is described here.)

Timeline for d1v66a_: