Lineage for d1v66a_ (1v66 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734562Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2734582Superfamily a.140.2: SAP domain [68906] (1 family) (S)
  5. 2734583Family a.140.2.1: SAP domain [68907] (8 proteins)
    Pfam PF02037
  6. 2734598Protein p53 binding domain of protein inhibitor of activated STAT protein 1, PIAS-1 [116764] (1 species)
  7. 2734599Species Human (Homo sapiens) [TaxId:9606] [116765] (1 PDB entry)
    Uniprot O75925 1-65
  8. 2734600Domain d1v66a_: 1v66 A: [113543]

Details for d1v66a_

PDB Entry: 1v66 (more details)

PDB Description: solution structure of human p53 binding domain of pias-1
PDB Compounds: (A:) Protein inhibitor of activated STAT protein 1

SCOPe Domain Sequences for d1v66a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v66a_ a.140.2.1 (A:) p53 binding domain of protein inhibitor of activated STAT protein 1, PIAS-1 {Human (Homo sapiens) [TaxId: 9606]}
madsaelkqmvmslrvselqvllgyagrnkhgrkhelltkalhllkagcspavqmkikel
yrrrf

SCOPe Domain Coordinates for d1v66a_:

Click to download the PDB-style file with coordinates for d1v66a_.
(The format of our PDB-style files is described here.)

Timeline for d1v66a_: