Class a: All alpha proteins [46456] (290 folds) |
Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
Superfamily a.140.2: SAP domain [68906] (1 family) |
Family a.140.2.1: SAP domain [68907] (8 proteins) Pfam PF02037 |
Protein p53 binding domain of protein inhibitor of activated STAT protein 1, PIAS-1 [116764] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [116765] (1 PDB entry) Uniprot O75925 1-65 |
Domain d1v66a_: 1v66 A: [113543] |
PDB Entry: 1v66 (more details)
SCOPe Domain Sequences for d1v66a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v66a_ a.140.2.1 (A:) p53 binding domain of protein inhibitor of activated STAT protein 1, PIAS-1 {Human (Homo sapiens) [TaxId: 9606]} madsaelkqmvmslrvselqvllgyagrnkhgrkhelltkalhllkagcspavqmkikel yrrrf
Timeline for d1v66a_: