Lineage for d1v5va2 (1v5v A:3-312)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1946403Fold d.250: Folate-binding domain [103024] (1 superfamily)
    duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands
  4. 1946404Superfamily d.250.1: Folate-binding domain [103025] (2 families) (S)
    some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase
  5. 1946405Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins)
  6. 1946406Protein Glycine cleavage system T protein, GcvT [111012] (4 species)
  7. 1946412Species Pyrococcus horikoshii [TaxId:53953] [117996] (1 PDB entry)
    Uniprot O58888
  8. 1946413Domain d1v5va2: 1v5v A:3-312 [113540]
    Other proteins in same PDB: d1v5va1, d1v5vb1
    complexed with gol, peg

Details for d1v5va2

PDB Entry: 1v5v (more details), 1.5 Å

PDB Description: Crystal Structure of a Component of Glycine Cleavage System: T-protein from Pyrococcus horikoshii OT3 at 1.5 A Resolution
PDB Compounds: (A:) Aminomethyltransferase

SCOPe Domain Sequences for d1v5va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5va2 d.250.1.1 (A:3-312) Glycine cleavage system T protein, GcvT {Pyrococcus horikoshii [TaxId: 53953]}
qmvkrvhifdwhkeharkieefagwempiwyssikeehlavrnavgifdvshmgeivfrg
kdalkflqyvttndiskppaisgtytlvlnergaikdetlvfnmgnneylmicdsdafek
lyawftylkrtieqftkldleielktydiamfavqgpkardlakdlfgidinemwwfqar
wveldgikmllsrsgytgengfevyiedanpyhpdeskrgepekalhvwerileegkkyg
ikpcglgardtlrleagytlygnetkelqllstdidevtplqanlefaiywdkdfigkda
llkqkergvg

SCOPe Domain Coordinates for d1v5va2:

Click to download the PDB-style file with coordinates for d1v5va2.
(The format of our PDB-style files is described here.)

Timeline for d1v5va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v5va1