Lineage for d1v5db_ (1v5d B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722054Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2722070Protein Chitosanase [116987] (1 species)
  7. 2722071Species Bacillus sp., strain k17 [TaxId:1409] [116988] (2 PDB entries)
    Uniprot Q9ALZ1 49-434
  8. 2722073Domain d1v5db_: 1v5d B: [113538]
    complexed with pin

Details for d1v5db_

PDB Entry: 1v5d (more details), 1.5 Å

PDB Description: The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4
PDB Compounds: (B:) Chitosanase

SCOPe Domain Sequences for d1v5db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5db_ a.102.1.2 (B:) Chitosanase {Bacillus sp., strain k17 [TaxId: 1409]}
akemkpfpqqvnyagvikpnhvtqeslnasvrsyydnwkkkylkndlsslpggyyvkgei
tgdadgfkplgtsegqgygmiitvlmagydsnaqkiydglfktartfkssqnpnlmgwvv
adskkaqghfdsatdgdldiayslllahkqwgsngtvnylkeaqdmitkgikasnvtnnn
qlnlgdwdskssldtrpsdwmmshlrafyeftgdktwltvinnlydvytqfsnkyspntg
lisdfvvknppqpapkdfldeseytnayyynasrvplrivmdyamygekrskvisdkvss
wiqnktngnpskivdgyqlngsnigsyptavfvspfiaasitssnnqkwvnsgwdwmknk
reryfsdsynlltmlfitgnwwkpvp

SCOPe Domain Coordinates for d1v5db_:

Click to download the PDB-style file with coordinates for d1v5db_.
(The format of our PDB-style files is described here.)

Timeline for d1v5db_: