Lineage for d1v5da_ (1v5d A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004092Protein Chitosanase [116987] (1 species)
  7. 2004093Species Bacillus sp., strain k17 [TaxId:1409] [116988] (2 PDB entries)
    Uniprot Q9ALZ1 49-434
  8. 2004094Domain d1v5da_: 1v5d A: [113537]
    complexed with pin

Details for d1v5da_

PDB Entry: 1v5d (more details), 1.5 Å

PDB Description: The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4
PDB Compounds: (A:) Chitosanase

SCOPe Domain Sequences for d1v5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5da_ a.102.1.2 (A:) Chitosanase {Bacillus sp., strain k17 [TaxId: 1409]}
akemkpfpqqvnyagvikpnhvtqeslnasvrsyydnwkkkylkndlsslpggyyvkgei
tgdadgfkplgtsegqgygmiitvlmagydsnaqkiydglfktartfkssqnpnlmgwvv
adskkaqghfdsatdgdldiayslllahkqwgsngtvnylkeaqdmitkgikasnvtnnn
qlnlgdwdskssldtrpsdwmmshlrafyeftgdktwltvinnlydvytqfsnkyspntg
lisdfvvknppqpapkdfldeseytnayyynasrvplrivmdyamygekrskvisdkvss
wiqnktngnpskivdgyqlngsnigsyptavfvspfiaasitssnnqkwvnsgwdwmknk
reryfsdsynlltmlfitgnwwkpvp

SCOPe Domain Coordinates for d1v5da_:

Click to download the PDB-style file with coordinates for d1v5da_.
(The format of our PDB-style files is described here.)

Timeline for d1v5da_: