Lineage for d1v4pc_ (1v4p C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605436Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 605437Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) (S)
    putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)
  5. 605451Family d.67.1.2: Hypothetical protein PH0574 [103051] (1 protein)
  6. 605452Protein Hypothetical protein PH0574 [103052] (1 species)
    stand-alone protein related to the AlaRS domain
  7. 605453Species Archaeon Pyrococcus horikoshii [TaxId:53953] [103053] (2 PDB entries)
  8. 605456Domain d1v4pc_: 1v4p C: [113535]
    complexed with zn2

Details for d1v4pc_

PDB Entry: 1v4p (more details), 1.45 Å

PDB Description: Crystal structure of Alanyl-tRNA Synthetase from Pyrococcus horikoshii OT3

SCOP Domain Sequences for d1v4pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4pc_ d.67.1.2 (C:) Hypothetical protein PH0574 {Archaeon Pyrococcus horikoshii}
mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
tkttgeigpikirkvrfrkskglleihfellelen

SCOP Domain Coordinates for d1v4pc_:

Click to download the PDB-style file with coordinates for d1v4pc_.
(The format of our PDB-style files is described here.)

Timeline for d1v4pc_: