Lineage for d1v4gc_ (1v4g C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581287Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2581288Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2581528Family d.128.1.4: Glutamate-cysteine ligase [118090] (2 proteins)
    Pfam PF04262
  6. 2581529Protein Gamma-glutamylcysteine synthetase GshA [118091] (1 species)
  7. 2581530Species Escherichia coli [TaxId:562] [118092] (2 PDB entries)
    Uniprot P0A6W9
  8. 2581535Domain d1v4gc_: 1v4g C: [113528]

Details for d1v4gc_

PDB Entry: 1v4g (more details), 2.5 Å

PDB Description: crystal structure of gamma-glutamylcysteine synthetase from escherichia coli b
PDB Compounds: (C:) Glutamate--cysteine ligase

SCOPe Domain Sequences for d1v4gc_:

Sequence, based on SEQRES records: (download)

>d1v4gc_ d.128.1.4 (C:) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
eilreedfvaereaserrqqemeaadtepfavwlekha

Sequence, based on observed residues (ATOM records): (download)

>d1v4gc_ d.128.1.4 (C:) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqakdisgadakekisagyfr
virnyyrfgwvipylfgaspaisssflslpfektgmyylpyatslrlsdlgytnksqsnl
gitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvt
rsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssse
lactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeay
qkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfv
aereaserrqqemeaadtepfavwlekha

SCOPe Domain Coordinates for d1v4gc_:

Click to download the PDB-style file with coordinates for d1v4gc_.
(The format of our PDB-style files is described here.)

Timeline for d1v4gc_: