Lineage for d1v4gc_ (1v4g C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610559Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 610560Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (4 families) (S)
  5. 610714Family d.128.1.4: Glutamate-cysteine ligase [118090] (1 protein)
    Pfam 04262
  6. 610715Protein Gamma-glutamylcysteine synthetase GshA [118091] (1 species)
  7. 610716Species Escherichia coli [TaxId:562] [118092] (2 PDB entries)
  8. 610721Domain d1v4gc_: 1v4g C: [113528]

Details for d1v4gc_

PDB Entry: 1v4g (more details), 2.5 Å

PDB Description: crystal structure of gamma-glutamylcysteine synthetase from escherichia coli b

SCOP Domain Sequences for d1v4gc_:

Sequence, based on SEQRES records: (download)

>d1v4gc_ d.128.1.4 (C:) Gamma-glutamylcysteine synthetase GshA {Escherichia coli}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
eilreedfvaereaserrqqemeaadtepfavwlekha

Sequence, based on observed residues (ATOM records): (download)

>d1v4gc_ d.128.1.4 (C:) Gamma-glutamylcysteine synthetase GshA {Escherichia coli}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqakdisgadakekisagyfr
virnyyrfgwvipylfgaspaisssflslpfektgmyylpyatslrlsdlgytnksqsnl
gitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvt
rsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssse
lactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeay
qkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfv
aereaserrqqemeaadtepfavwlekha

SCOP Domain Coordinates for d1v4gc_:

Click to download the PDB-style file with coordinates for d1v4gc_.
(The format of our PDB-style files is described here.)

Timeline for d1v4gc_: