Lineage for d1v43a1 (1v43 A:246-299)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1790106Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 1790190Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 1790204Protein Hypothetical protein PH0022, C-terminal domain [117208] (1 species)
  7. 1790205Species Pyrococcus horikoshii [TaxId:53953] [117209] (2 PDB entries)
    Uniprot O57758
  8. 1790206Domain d1v43a1: 1v43 A:246-299 [113521]
    Other proteins in same PDB: d1v43a3

Details for d1v43a1

PDB Entry: 1v43 (more details), 2.2 Å

PDB Description: crystal structure of atpase subunit of abc sugar transporter
PDB Compounds: (A:) sugar-binding transport ATP-binding protein

SCOPe Domain Sequences for d1v43a1:

Sequence, based on SEQRES records: (download)

>d1v43a1 b.40.6.3 (A:246-299) Hypothetical protein PH0022, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
pemnilevsvgdgylegrgfrielpqdlmdllkdyvgktvlfgirpehmtvegv

Sequence, based on observed residues (ATOM records): (download)

>d1v43a1 b.40.6.3 (A:246-299) Hypothetical protein PH0022, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
pemnilevsvgdgylegrgfrielpqmdllkdyvgktvlfgirpehmtvegv

SCOPe Domain Coordinates for d1v43a1:

Click to download the PDB-style file with coordinates for d1v43a1.
(The format of our PDB-style files is described here.)

Timeline for d1v43a1: