Lineage for d1v40c2 (1v40 C:402-475)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 585063Protein Class sigma GST [81362] (5 species)
  7. 585076Species Human (Homo sapiens) [TaxId:9606] [89705] (3 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 585087Domain d1v40c2: 1v40 C:402-475 [113517]
    Other proteins in same PDB: d1v40a1, d1v40b1, d1v40c1, d1v40d1

Details for d1v40c2

PDB Entry: 1v40 (more details), 1.9 Å

PDB Description: First Inhibitor Complex Structure of Human Hematopoietic Prostaglandin D Synthase

SCOP Domain Sequences for d1v40c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v40c2 c.47.1.5 (C:402-475) Class sigma GST {Human (Homo sapiens)}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOP Domain Coordinates for d1v40c2:

Click to download the PDB-style file with coordinates for d1v40c2.
(The format of our PDB-style files is described here.)

Timeline for d1v40c2: