SCOP 1.75: Domain d1v40c1: 1v40 C:476-599

Lineage for d1v40c1 (1v40 C:476-599)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89061] (11 PDB entries)
   Uniprot O60760; synonym: hematopoietic prostaglandin D synthase

8. Domain d1v40c1: 1v40 C:476-599 [113516]
   Other proteins in same PDB: d1v40a2, d1v40b2, d1v40c2, d1v40d2

Details for d1v40c1

PDB Entry: 1v40, 1.9 Å

PDB Description: First Inhibitor Complex Structure of Human Hematopoietic Prostaglandin D Synthase

PDB Compounds: (C:) glutathione-requiring prostaglandin d synthase

SCOP Domain Sequences for d1v40c1:

Sequence; same for both SEQRES and ATOM records:

>d1v40c1 a.45.1.1 (C:476-599) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d1v40c1:

• d1v40c1 first appeared in SCOP 1.71
  
• d1v40c1 appears in SCOP 1.73
  
• d1v40c1 appears in SCOPe 2.01
  
• d1v40c1 appears in the current release, SCOPe 2.08