Lineage for d1v40a1 (1v40 A:76-199)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270996Protein Class sigma GST [81351] (5 species)
  7. 1271009Species Human (Homo sapiens) [TaxId:9606] [89061] (13 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 1271022Domain d1v40a1: 1v40 A:76-199 [113512]
    Other proteins in same PDB: d1v40a2, d1v40b2, d1v40c2, d1v40d2
    complexed with gol, gsh, mg, o16

Details for d1v40a1

PDB Entry: 1v40 (more details), 1.9 Å

PDB Description: First Inhibitor Complex Structure of Human Hematopoietic Prostaglandin D Synthase
PDB Compounds: (A:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d1v40a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v40a1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d1v40a1:

Click to download the PDB-style file with coordinates for d1v40a1.
(The format of our PDB-style files is described here.)

Timeline for d1v40a1: