Lineage for d1v3zb_ (1v3z B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909557Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 1909558Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
    automatically mapped to Pfam PF00708
  6. 1909559Protein Acylphosphatase [54977] (4 species)
  7. 1909564Species Pyrococcus horikoshii [TaxId:53953] [110973] (2 PDB entries)
    Uniprot P84142
  8. 1909568Domain d1v3zb_: 1v3z B: [113511]
    complexed with cl, k

Details for d1v3zb_

PDB Entry: 1v3z (more details), 1.72 Å

PDB Description: Crystal Structure of Acylphosphatase from Pyrococcus horikoshii
PDB Compounds: (B:) acylphosphatase

SCOPe Domain Sequences for d1v3zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3zb_ d.58.10.1 (B:) Acylphosphatase {Pyrococcus horikoshii [TaxId: 53953]}
aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
ahqgpplarvtrvevkweqpkgekgfrivg

SCOPe Domain Coordinates for d1v3zb_:

Click to download the PDB-style file with coordinates for d1v3zb_.
(The format of our PDB-style files is described here.)

Timeline for d1v3zb_: