Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) |
Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins) automatically mapped to Pfam PF00708 |
Protein Acylphosphatase [54977] (4 species) |
Species Pyrococcus horikoshii [TaxId:53953] [110973] (2 PDB entries) Uniprot P84142 |
Domain d1v3zb_: 1v3z B: [113511] complexed with cl, k |
PDB Entry: 1v3z (more details), 1.72 Å
SCOPe Domain Sequences for d1v3zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3zb_ d.58.10.1 (B:) Acylphosphatase {Pyrococcus horikoshii [TaxId: 53953]} aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw ahqgpplarvtrvevkweqpkgekgfrivg
Timeline for d1v3zb_: