SCOPe 2.08: Domain d1v3zb_: 1v3z B:

Lineage for d1v3zb_ (1v3z B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families)

5. Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
   automatically mapped to Pfam PF00708

6. Protein Acylphosphatase [54977] (4 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [110973] (2 PDB entries)
   Uniprot P84142

8. Domain d1v3zb_: 1v3z B: [113511]
   complexed with cl, k

Details for d1v3zb_

PDB Entry: 1v3z, 1.72 Å

PDB Description: Crystal Structure of Acylphosphatase from Pyrococcus horikoshii

PDB Compounds: (B:) acylphosphatase

SCOPe Domain Sequences for d1v3zb_:

Sequence; same for both SEQRES and ATOM records:

>d1v3zb_ d.58.10.1 (B:) Acylphosphatase {Pyrococcus horikoshii [TaxId: 53953]}
aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
ahqgpplarvtrvevkweqpkgekgfrivg

Timeline for d1v3zb_:

• d1v3zb_ first appeared in SCOP 1.71
  
• d1v3zb_ appears in SCOPe 2.07