Lineage for d1v3ya_ (1v3y A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2606868Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2606869Protein Peptide deformylase [56422] (11 species)
  7. 2606991Species Thermus thermophilus [TaxId:274] [118165] (1 PDB entry)
    Uniprot P43522
  8. 2606992Domain d1v3ya_: 1v3y A: [113508]

Details for d1v3ya_

PDB Entry: 1v3y (more details), 1.81 Å

PDB Description: The crystal structure of peptide deformylase from Thermus thermophilus HB8
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d1v3ya_:

Sequence, based on SEQRES records: (download)

>d1v3ya_ d.167.1.1 (A:) Peptide deformylase {Thermus thermophilus [TaxId: 274]}
mvypirlygdpvlrrkarpvedfsgikrlaedmletmfeakgvglaapqiglsqrlfvav
eyadepegeeerplrelvrrvyvvanpvityreglvegtegclslpglyseevpraerir
veyqdeegrgrvlelegymarvfqheidhldgilfferlpkpkreafleanraelvrfqk
ea

Sequence, based on observed residues (ATOM records): (download)

>d1v3ya_ d.167.1.1 (A:) Peptide deformylase {Thermus thermophilus [TaxId: 274]}
mvypirlygdpvlrrkarpvedfsgikrlaedmletmfeakgvglaapqiglsqrlfvav
elrelvrrvyvvanpvityreglvegtegclslpglyseevpraerirveyqdeegrgrv
lelegymarvfqheidhldgilfferlpkpkreafleanraelvrfqkea

SCOPe Domain Coordinates for d1v3ya_:

Click to download the PDB-style file with coordinates for d1v3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1v3ya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v3yb_