![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
![]() | Protein PII (product of glnB) [54915] (7 species) trimer with orthogonal packing of beta-sheets around the threefold axis |
![]() | Species Thermus thermophilus [TaxId:274] [102972] (5 PDB entries) Uniprot P83820 |
![]() | Domain d1v3rb_: 1v3r B: [113501] Structural genomics target |
PDB Entry: 1v3r (more details), 1.85 Å
SCOPe Domain Sequences for d1v3rb_:
Sequence, based on SEQRES records: (download)
>d1v3rb_ d.58.5.1 (B:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]} mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeed
>d1v3rb_ d.58.5.1 (B:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]} mklivaivrpeklnevlkalfqaevrgltlsrvqghgelhekvrleigvsepfvkptvea ilkaartgevgdgkifvlpvekvyrirtgeed
Timeline for d1v3rb_: