Lineage for d1v3ra_ (1v3r A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950564Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2950570Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 2950611Species Thermus thermophilus [TaxId:274] [102972] (5 PDB entries)
    Uniprot P83820
  8. 2950615Domain d1v3ra_: 1v3r A: [113500]
    Structural genomics target

Details for d1v3ra_

PDB Entry: 1v3r (more details), 1.85 Å

PDB Description: crystal structure of tt1020 from thermus thermophilus hb8
PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d1v3ra_:

Sequence, based on SEQRES records: (download)

>d1v3ra_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeede

Sequence, based on observed residues (ATOM records): (download)

>d1v3ra_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghelhekvrleigvsepfvkptveai
lkaartgevgdgkifvlpvekvyrirtgeede

SCOPe Domain Coordinates for d1v3ra_:

Click to download the PDB-style file with coordinates for d1v3ra_.
(The format of our PDB-style files is described here.)

Timeline for d1v3ra_: