Lineage for d1v3aa_ (1v3a A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875107Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2875137Protein Protein tyrosine phosphatase type IVa [102418] (3 species)
  7. 2875142Species Human (Homo sapiens), pr-3 [TaxId:9606] [102419] (4 PDB entries)
    Uniprot O75365 1-162 # 99% sequence identity
  8. 2875146Domain d1v3aa_: 1v3a A: [113499]

Details for d1v3aa_

PDB Entry: 1v3a (more details)

PDB Description: structure of human prl-3, the phosphatase associated with cancer metastasis
PDB Compounds: (A:) protein tyrosine phosphatase type IVA

SCOPe Domain Sequences for d1v3aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3aa_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-3 [TaxId: 9606]}
marmnrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktplek
dgitvvdwpfddgapppgkvvedwlslvkakfceapgscvavhcvaglgrapvlvalali
esgmkyedaiqfirqkrrgainskqltylekyrpkqrlrfkd

SCOPe Domain Coordinates for d1v3aa_:

Click to download the PDB-style file with coordinates for d1v3aa_.
(The format of our PDB-style files is described here.)

Timeline for d1v3aa_: