SCOP 1.71: Domain d1v37b_: 1v37 B:

Lineage for d1v37b_ (1v37 B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (3 proteins)

6. Protein Alpha-ribazole-5'-phosphate phosphatase [117669] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117670] (1 PDB entry)

8. Domain d1v37b_: 1v37 B: [113498]
   complexed with gol

Details for d1v37b_

PDB Entry: 1v37, 1.4 Å

PDB Description: Crystal structure of phosphoglycerate mutase from Thermus thermophilus HB8

SCOP Domain Sequences for d1v37b_:

Sequence; same for both SEQRES and ATOM records:

>d1v37b_ c.60.1.1 (B:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlal

Timeline for d1v37b_:

• d1v37b_ is new in SCOP 1.71
  
• d1v37b_ appears in SCOP 1.73
  
• d1v37b_ appears in the current release, SCOPe 2.08