![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
![]() | Protein Alpha-ribazole-5'-phosphate phosphatase [117669] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [117670] (1 PDB entry) Uniprot Q53WB3 |
![]() | Domain d1v37b_: 1v37 B: [113498] complexed with gol |
PDB Entry: 1v37 (more details), 1.4 Å
SCOPe Domain Sequences for d1v37b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v37b_ c.60.1.1 (B:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlal
Timeline for d1v37b_: