SCOP 1.75: Domain d1v37a_: 1v37 A:

Lineage for d1v37a_ (1v37 A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (3 proteins)

6. Protein Alpha-ribazole-5'-phosphate phosphatase [117669] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117670] (2 PDB entries)
   Uniprot Q53WB3

8. Domain d1v37a_: 1v37 A: [113497]

Details for d1v37a_

PDB Entry: 1v37, 1.4 Å

PDB Description: Crystal structure of phosphoglycerate mutase from Thermus thermophilus HB8

PDB Compounds: (A:) phosphoglycerate mutase

SCOP Domain Sequences for d1v37a_:

Sequence; same for both SEQRES and ATOM records:

>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlald

Timeline for d1v37a_:

• d1v37a_ first appeared in SCOP 1.71
  
• d1v37a_ appears in SCOP 1.73
  
• d1v37a_ appears in SCOPe 2.01
  
• d1v37a_ appears in the current release, SCOPe 2.08