Lineage for d1v30a_ (1v30 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 617077Fold d.269: BtrG-like [110856] (1 superfamily)
    beta-alpha-beta(4)-alpha-beta(2); contains beta-sheet barrel (n=5, S=8)
  4. 617078Superfamily d.269.1: BtrG-like [110857] (1 family) (S)
  5. 617079Family d.269.1.1: BtrG-like [110858] (3 proteins)
    Pfam 03674
  6. 617083Protein Hypothetical protein PH0828 [117851] (1 species)
  7. 617084Species Pyrococcus horikoshii [TaxId:70601] [117852] (1 PDB entry)
  8. 617085Domain d1v30a_: 1v30 A: [113496]
    Structural genomics target
    complexed with nhe

Details for d1v30a_

PDB Entry: 1v30 (more details), 1.4 Å

PDB Description: Crystal Structure Of Uncharacterized Protein PH0828 From Pyrococcus horikoshii

SCOP Domain Sequences for d1v30a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v30a_ d.269.1.1 (A:) Hypothetical protein PH0828 {Pyrococcus horikoshii}
svriavygtlrkgkplhwylkgakflgedwiegyqlyfeylpyavkgkgklkvevyevdk
etferineieigtgyrlvevstkfgkaflwewgskprgkriksgdfdeirlehhhhhh

SCOP Domain Coordinates for d1v30a_:

Click to download the PDB-style file with coordinates for d1v30a_.
(The format of our PDB-style files is described here.)

Timeline for d1v30a_: