![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.269: Gamma-glutamyl cyclotransferase-like [110856] (1 superfamily) beta-alpha-beta(4)-alpha-beta(2); contains beta-sheet barrel (n=5, S=8) |
![]() | Superfamily d.269.1: Gamma-glutamyl cyclotransferase-like [110857] (1 family) ![]() |
![]() | Family d.269.1.1: Gamma-glutamyl cyclotransferase-like [110858] (4 proteins) Pfam PF03674 |
![]() | Protein Hypothetical protein PH0828 [117851] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [117852] (1 PDB entry) Uniprot O58558 |
![]() | Domain d1v30a1: 1v30 A:7-116 [113496] Other proteins in same PDB: d1v30a2 Structural genomics target complexed with nhe |
PDB Entry: 1v30 (more details), 1.4 Å
SCOPe Domain Sequences for d1v30a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v30a1 d.269.1.1 (A:7-116) Hypothetical protein PH0828 {Pyrococcus horikoshii [TaxId: 53953]} svriavygtlrkgkplhwylkgakflgedwiegyqlyfeylpyavkgkgklkvevyevdk etferineieigtgyrlvevstkfgkaflwewgskprgkriksgdfdeir
Timeline for d1v30a1: