Lineage for d1v2ga_ (1v2g A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579135Superfamily c.23.10: SGNH hydrolase [52266] (6 families) (S)
  5. 579167Family c.23.10.5: Thioesterase I, TAP [89594] (1 protein)
  6. 579168Protein Thioesterase I, TAP [89595] (1 species)
    multifunctional enzyme with thioesterase, esterase, protease and lysophospholiase activities
  7. 579169Species Escherichia coli [TaxId:562] [89596] (4 PDB entries)
  8. 579172Domain d1v2ga_: 1v2g A: [113495]
    complexed with imd, oca, so4; mutant

Details for d1v2ga_

PDB Entry: 1v2g (more details), 2 Å

PDB Description: the l109p mutant of e. coli thioesterase i/protease i/lysophospholipase l1 (tap) in complexed with octanoic acid

SCOP Domain Sequences for d1v2ga_:

Sequence, based on SEQRES records: (download)

>d1v2ga_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli}
adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirppanygrrynea
fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvn

Sequence, based on observed residues (ATOM records): (download)

>d1v2ga_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli}
adtllilgdslsagyrmsasaawpallndkwsktsvvnasisgdtsqqglarlpallkqh
qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirppanygrryneaf
saiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvn

SCOP Domain Coordinates for d1v2ga_:

Click to download the PDB-style file with coordinates for d1v2ga_.
(The format of our PDB-style files is described here.)

Timeline for d1v2ga_: