Lineage for d1v2ga_ (1v2g A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857432Family c.23.10.5: TAP-like [89594] (3 proteins)
    automatically mapped to Pfam PF00657
    automatically mapped to Pfam PF13472
  6. 2857436Protein Thioesterase I, TAP [89595] (1 species)
    multifunctional enzyme with thioesterase, esterase, protease and lysophospholiase activities
  7. 2857437Species Escherichia coli [TaxId:562] [89596] (5 PDB entries)
    Uniprot P29679 27-205
  8. 2857441Domain d1v2ga_: 1v2g A: [113495]
    complexed with imd, oca, so4; mutant

Details for d1v2ga_

PDB Entry: 1v2g (more details), 2 Å

PDB Description: the l109p mutant of e. coli thioesterase i/protease i/lysophospholipase l1 (tap) in complexed with octanoic acid
PDB Compounds: (A:) Acyl-CoA Thioesterase I

SCOPe Domain Sequences for d1v2ga_:

Sequence, based on SEQRES records: (download)

>d1v2ga_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli [TaxId: 562]}
adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirppanygrrynea
fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvn

Sequence, based on observed residues (ATOM records): (download)

>d1v2ga_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli [TaxId: 562]}
adtllilgdslsagyrmsasaawpallndkwsktsvvnasisgdtsqqglarlpallkqh
qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirppanygrryneaf
saiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvn

SCOPe Domain Coordinates for d1v2ga_:

Click to download the PDB-style file with coordinates for d1v2ga_.
(The format of our PDB-style files is described here.)

Timeline for d1v2ga_: