Lineage for d1v29a_ (1v29 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. Protein Cobalt-containing nitrile hydratase [82799] (2 species)
  7. Species Bacillus smithii [TaxId:1479] [118143] (1 PDB entry)
    Uniprot Q84FS5 # 93% sequence identity; Bacillus sp. RAPc8 TaxID: 218609
  8. Domain d1v29a_: 1v29 A: [113493]
    Other proteins in same PDB: d1v29b_
    complexed with co

Details for d1v29a_

PDB Entry: 1v29 (more details), 2.6 Å

PDB Description: crystal structure of nitrile hydratase from a thermophile bacillus smithii
PDB Compounds: (A:) nitrile hydratase a chain

SCOPe Domain Sequences for d1v29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v29a_ d.149.1.1 (A:) Cobalt-containing nitrile hydratase {Bacillus smithii [TaxId: 1479]}
dprfphhhprpqsfwearakaleslliekrllssdaiervikhyehelgpmngakvvaka
wtdpefkqrlledpetvlrelgyfglqgehirvventdtvhnvvvctlcscypwpllglp
pswykepayrsrvvkeprkvlqefgldlpdsveirvwdsssevrfmvlpqrpegtegmte
eelaqivtrdsmigvakvqppkv

SCOPe Domain Coordinates for d1v29a_ are not available.

Timeline for d1v29a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v29b_