SCOPe 2.05: Domain d1v1qb_: 1v1q B:

Lineage for d1v1qb_ (1v1q B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein Primosomal replication protein N, PriB [117191] (1 species)

7. Species Escherichia coli [TaxId:562] [117192] (2 PDB entries)
   Uniprot P07013

8. Domain d1v1qb_: 1v1q B: [113491]
   complexed with cys

Details for d1v1qb_

PDB Entry: 1v1q, 2.1 Å

PDB Description: crystal structure of prib- a primosomal dna replication protein of escherichia coli

PDB Compounds: (B:) primosomal replication protein n

SCOPe Domain Sequences for d1v1qb_:

Sequence; same for both SEQRES and ATOM records:

>d1v1qb_ b.40.4.3 (B:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]}
grdpnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvi
vsghenqaithsitvgsritvqgfischkaknglskmvlhaeqielidsvdk

Timeline for d1v1qb_:

• d1v1qb_ first appeared in SCOP 1.71
  
• d1v1qb_ appears in SCOPe 2.04
  
• d1v1qb_ is called d1v1qb1 in SCOPe 2.06
  
• d1v1qb_ appears in the current release, SCOPe 2.08, called d1v1qb1