![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Primosomal replication protein N, PriB [117191] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117192] (3 PDB entries) Uniprot P07013 |
![]() | Domain d1v1qb_: 1v1q B: [113491] complexed with cys; mutant |
PDB Entry: 1v1q (more details), 2.1 Å
SCOP Domain Sequences for d1v1qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1qb_ b.40.4.3 (B:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} grdpnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvi vsghenqaithsitvgsritvqgfischkaknglskmvlhaeqielidsvdk
Timeline for d1v1qb_: