Lineage for d1v1qb_ (1v1q B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559685Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) (S)
  5. 559752Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 559794Protein Primosomal replication protein N, PriB [117191] (1 species)
  7. 559795Species Escherichia coli [TaxId:562] [117192] (2 PDB entries)
  8. 559797Domain d1v1qb_: 1v1q B: [113491]
    complexed with cys; mutant

Details for d1v1qb_

PDB Entry: 1v1q (more details), 2.1 Å

PDB Description: crystal structure of prib- a primosomal dna replication protein of escherichia coli

SCOP Domain Sequences for d1v1qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1qb_ b.40.4.3 (B:) Primosomal replication protein N, PriB {Escherichia coli}
grdpnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvi
vsghenqaithsitvgsritvqgfischkaknglskmvlhaeqielidsvdk

SCOP Domain Coordinates for d1v1qb_:

Click to download the PDB-style file with coordinates for d1v1qb_.
(The format of our PDB-style files is described here.)

Timeline for d1v1qb_: