Lineage for d1v1qb1 (1v1q B:-4-104)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789388Protein Primosomal replication protein N, PriB [117191] (1 species)
  7. 2789389Species Escherichia coli [TaxId:562] [117192] (2 PDB entries)
    Uniprot P07013
  8. 2789391Domain d1v1qb1: 1v1q B:-4-104 [113491]
    Other proteins in same PDB: d1v1qa2, d1v1qb2, d1v1qb3
    complexed with cys
    missing some secondary structures that made up less than one-third of the common domain

Details for d1v1qb1

PDB Entry: 1v1q (more details), 2.1 Å

PDB Description: crystal structure of prib- a primosomal dna replication protein of escherichia coli
PDB Compounds: (B:) primosomal replication protein n

SCOPe Domain Sequences for d1v1qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1qb1 b.40.4.3 (B:-4-104) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]}
pnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsg
henqaithsitvgsritvqgfischkaknglskmvlhaeqielidsvd

SCOPe Domain Coordinates for d1v1qb1:

Click to download the PDB-style file with coordinates for d1v1qb1.
(The format of our PDB-style files is described here.)

Timeline for d1v1qb1: