![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Primosomal replication protein N, PriB [117191] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117192] (2 PDB entries) Uniprot P07013 |
![]() | Domain d1v1qb1: 1v1q B:-4-104 [113491] Other proteins in same PDB: d1v1qa2, d1v1qb2, d1v1qb3 complexed with cys missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1v1q (more details), 2.1 Å
SCOPe Domain Sequences for d1v1qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1qb1 b.40.4.3 (B:-4-104) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} pnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsg henqaithsitvgsritvqgfischkaknglskmvlhaeqielidsvd
Timeline for d1v1qb1: