Lineage for d1v1qa_ (1v1q A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799474Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 799517Protein Primosomal replication protein N, PriB [117191] (1 species)
  7. 799518Species Escherichia coli [TaxId:562] [117192] (3 PDB entries)
    Uniprot P07013
  8. 799519Domain d1v1qa_: 1v1q A: [113490]

Details for d1v1qa_

PDB Entry: 1v1q (more details), 2.1 Å

PDB Description: crystal structure of prib- a primosomal dna replication protein of escherichia coli
PDB Compounds: (A:) primosomal replication protein n

SCOP Domain Sequences for d1v1qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]}
pnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsg
henqaithsitvgsritvqgfischkaknglskmvlhaeqielidsvdkla

SCOP Domain Coordinates for d1v1qa_:

Click to download the PDB-style file with coordinates for d1v1qa_.
(The format of our PDB-style files is described here.)

Timeline for d1v1qa_: