SCOPe 2.08: Domain d1v1qa1: 1v1q A:-4-104

Lineage for d1v1qa1 (1v1q A:-4-104)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
   barrel, closed; n=5, S=10

6. Protein Primosomal replication protein N, PriB [117191] (1 species)

7. Species Escherichia coli [TaxId:562] [117192] (2 PDB entries)
   Uniprot P07013

8. Domain d1v1qa1: 1v1q A:-4-104 [113490]
   Other proteins in same PDB: d1v1qa2, d1v1qb2, d1v1qb3
   complexed with cys
   missing some secondary structures that made up less than one-third of the common domain

Details for d1v1qa1

PDB Entry: 1v1q, 2.1 Å

PDB Description: crystal structure of prib- a primosomal dna replication protein of escherichia coli

PDB Compounds: (A:) primosomal replication protein n

SCOPe Domain Sequences for d1v1qa1:

Sequence; same for both SEQRES and ATOM records:

>d1v1qa1 b.40.4.3 (A:-4-104) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]}
pnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsg
henqaithsitvgsritvqgfischkaknglskmvlhaeqielidsvd

Timeline for d1v1qa1:

• d1v1qa1 first appeared in SCOP 1.71, called d1v1qa_
  
• d1v1qa1 appears in SCOPe 2.07