SCOP 1.73: Domain d1v0ff2: 1v0f F:761-910

Lineage for d1v0ff2 (1v0f F:761-910)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
   (homo)trimer; each chain donates 3 beta-strands per turn of the helix

4. Superfamily b.108.1: Phage fibre proteins [69349] (4 families)

5. Family b.108.1.3: Endo-alpha-sialidase [117325] (1 protein)

6. Protein Endo-alpha-sialidase [117326] (1 species)

7. Species Bacteriophage K1F [TaxId:344021] [117327] (2 PDB entries)

8. Domain d1v0ff2: 1v0f F:761-910 [113489]
   Other proteins in same PDB: d1v0fa1, d1v0fb1, d1v0fc1, d1v0fd1, d1v0fe1, d1v0ff1
   complexed with po4, sia, slb

Details for d1v0ff2

PDB Entry: 1v0f, 2.55 Å

PDB Description: endosialidase of bacteriophage k1f in complex with oligomeric alpha-2, 8-sialic acid

PDB Compounds: (F:) endo-alpha-sialidase

SCOP Domain Sequences for d1v0ff2:

Sequence; same for both SEQRES and ATOM records:

>d1v0ff2 b.108.1.3 (F:761-910) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]}
srdfrygavpnravpvffdtngvrtvpapmeftgdlglghvtirastssnirsevlmege
ygfigksiptdnpagqriifcggegtssttgaqitlyganntdsrrivyngdehlfqsad
vkpyndnvtalggpsnrfttaylgsnpivt

Timeline for d1v0ff2:

• d1v0ff2 first appeared in SCOP 1.71
  
• d1v0ff2 appears in SCOP 1.75
  
• d1v0ff2 appears in the current release, SCOPe 2.08