![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily) (homo)trimer; each chain donates 3 beta-strands per turn of the helix |
![]() | Superfamily b.108.1: Phage fibre proteins [69349] (3 families) ![]() |
![]() | Family b.108.1.3: Endo-alpha-sialidase [117325] (1 protein) |
![]() | Protein Endo-alpha-sialidase [117326] (1 species) |
![]() | Species Bacteriophage K1F [TaxId:344021] [117327] (2 PDB entries) |
![]() | Domain d1v0fe2: 1v0f E:761-910 [113487] Other proteins in same PDB: d1v0fa1, d1v0fb1, d1v0fc1, d1v0fd1, d1v0fe1, d1v0ff1 |
PDB Entry: 1v0f (more details), 2.55 Å
SCOP Domain Sequences for d1v0fe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v0fe2 b.108.1.3 (E:761-910) Endo-alpha-sialidase {Bacteriophage K1F} srdfrygavpnravpvffdtngvrtvpapmeftgdlglghvtirastssnirsevlmege ygfigksiptdnpagqriifcggegtssttgaqitlyganntdsrrivyngdehlfqsad vkpyndnvtalggpsnrfttaylgsnpivt
Timeline for d1v0fe2: