| Class b: All beta proteins [48724] (149 folds) |
| Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily) (homo)trimer; each chain donates 3 beta-strands per turn of the helix |
Superfamily b.108.1: Phage fibre proteins [69349] (3 families) ![]() |
| Family b.108.1.3: Endo-alpha-sialidase [117325] (1 protein) |
| Protein Endo-alpha-sialidase [117326] (1 species) |
| Species Bacteriophage K1F [TaxId:344021] [117327] (2 PDB entries) |
| Domain d1v0fd2: 1v0f D:761-910 [113485] Other proteins in same PDB: d1v0fa1, d1v0fb1, d1v0fc1, d1v0fd1, d1v0fe1, d1v0ff1 |
PDB Entry: 1v0f (more details), 2.55 Å
SCOP Domain Sequences for d1v0fd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v0fd2 b.108.1.3 (D:761-910) Endo-alpha-sialidase {Bacteriophage K1F}
srdfrygavpnravpvffdtngvrtvpapmeftgdlglghvtirastssnirsevlmege
ygfigksiptdnpagqriifcggegtssttgaqitlyganntdsrrivyngdehlfqsad
vkpyndnvtalggpsnrfttaylgsnpivt
Timeline for d1v0fd2: