Lineage for d1v0fd1 (1v0f D:245-760)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2065368Family b.68.1.2: Endo-alpha-sialidase [117276] (2 protein domains)
    possibly related by the other family by circular permutation; includes extra N-terminal domain [dN: alpha/beta ] and insert domain [dI: beta-barrel, similar to the Reductase/isomerase/elongation factor common domain (50412)]
  6. 2065369Protein Endo-alpha-sialidase [117277] (1 species)
  7. 2065370Species Bacteriophage K1F [TaxId:344021] [117278] (2 PDB entries)
    Uniprot Q04830 245-909
  8. 2065380Domain d1v0fd1: 1v0f D:245-760 [113484]
    Other proteins in same PDB: d1v0fa2, d1v0fb2, d1v0fc2, d1v0fd2, d1v0fe2, d1v0ff2
    complexed with po4, slb

Details for d1v0fd1

PDB Entry: 1v0f (more details), 2.55 Å

PDB Description: endosialidase of bacteriophage k1f in complex with oligomeric alpha-2,8-sialic acid
PDB Compounds: (D:) endo-alpha-sialidase

SCOPe Domain Sequences for d1v0fd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v0fd1 b.68.1.2 (D:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]}
sakgdgvtddtaaltsalndtpvgqkingngktykvtslpdisrfintrfvyeripgqpl
yyaseefvqgelfkitdtpyynawpqdkafvyenviyapymgsdrhgvsrlhvswvksgd
dgqtwstpewltdlhpdyptvnyhcmsmgvcrnrlfamietrtlaknaltncalwdrpms
rslhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftv
ltpnqqtsdlnnagknwhmgtsfhkspwrktdlglipsvtevhsfatidnngfamgyhqg
dvaprevglfyfpdafnspsnyvrrqipseyepdasepcikyydgvlylitrgtrgdrlg
sslhrsrdigqtweslrfphnvhhttlpfakvgddlimfgseraeneweagapddrykas
yprtfyarlnvnnwnaddiewvnitdqiyqggivnsgvgvgsvvvkdnyiyymfggedhf
npwtygdnsakdpfksdghpsdlycykmkigpdnrv

SCOPe Domain Coordinates for d1v0fd1:

Click to download the PDB-style file with coordinates for d1v0fd1.
(The format of our PDB-style files is described here.)

Timeline for d1v0fd1: