Lineage for d1v0fc2 (1v0f C:761-910)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821021Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
    (homo)trimer; each chain donates 3 beta-strands per turn of the helix
  4. 2821022Superfamily b.108.1: Phage fibre proteins [69349] (6 families) (S)
  5. 2821031Family b.108.1.3: Endo-alpha-sialidase [117325] (1 protein)
    automatically mapped to Pfam PF12219
  6. 2821032Protein Endo-alpha-sialidase [117326] (1 species)
  7. 2821033Species Bacteriophage K1F [TaxId:344021] [117327] (2 PDB entries)
    Uniprot Q04830 245-909
  8. 2821042Domain d1v0fc2: 1v0f C:761-910 [113483]
    Other proteins in same PDB: d1v0fa1, d1v0fb1, d1v0fc1, d1v0fd1, d1v0fe1, d1v0ff1
    complexed with po4, slb

Details for d1v0fc2

PDB Entry: 1v0f (more details), 2.55 Å

PDB Description: endosialidase of bacteriophage k1f in complex with oligomeric alpha-2, 8-sialic acid
PDB Compounds: (C:) endo-alpha-sialidase

SCOPe Domain Sequences for d1v0fc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v0fc2 b.108.1.3 (C:761-910) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]}
srdfrygavpnravpvffdtngvrtvpapmeftgdlglghvtirastssnirsevlmege
ygfigksiptdnpagqriifcggegtssttgaqitlyganntdsrrivyngdehlfqsad
vkpyndnvtalggpsnrfttaylgsnpivt

SCOPe Domain Coordinates for d1v0fc2:

Click to download the PDB-style file with coordinates for d1v0fc2.
(The format of our PDB-style files is described here.)

Timeline for d1v0fc2: